-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSL/LIPE was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 901-1000 of human HSL/LIPE (NP_005348.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HSL/LIPE was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 901-1000 of human HSL/LIPE (NP_005348.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15559A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSL/LIPE |
| Target Synonyms | HSL; LHS; REH; AOMS4; FPLD6; HSL/LIPE | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse fat | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 901-1000 of human HSL/LIPE (NP_005348.2). | Immunogen Sequence | LSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLYSSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDS |
|---|---|---|---|
| Uniprot ID | Q05469 |
Uniprot Id
Q05469
Target Species
Human
Target Name
LIPE
Target Full Name
Hormone-sensitive lipase
Target Function
Lipase with broad substrate specificity, catalyzing the hydrolysis of triacylglycerols (TAGs), diacylglycerols (DAGs), monoacylglycerols (MAGs), cholesteryl esters and retinyl esters. Shows a preferential hydrolysis of DAGs over TAGs and MAGs and preferentially hydrolyzes the fatty acid (FA) esters at the sn-3 position of the glycerol backbone in DAGs. Preferentially hydrolyzes FA esters at the sn-1 and sn-2 positions of the glycerol backbone in TAGs. Catalyzes the hydrolysis of 2-arachidonoylglycerol, an endocannabinoid and of 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor. In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production.
Target Involvement
Lipodystrophy, familial partial, 6 (FPLD6)
Target Subcellular Location
Cell membrane. Membrane, caveola. Cytoplasm, cytosol. Lipid droplet.
Target Protein Families
'GDXG' lipolytic enzyme family
Target Tissue Specificity
Testis.
Target Synonyms
Hormone sensitive lipase; Hormone sensitive lipase testicular isoform; Hormone-sensitive lipase; HSL; LHS; Lipase hormone sensitive ; LIPE; LIPS_HUMAN
Target Background
The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids.
Notification