-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACHA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human ACHA4 (P43681) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ACHA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human ACHA4 (P43681) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14105A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACHA4 |
| Target Synonyms | EBN; BFNC; EBN1; NACHR; NACRA4; NACHRA4; ACHA4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Mouse brain, Mouse liver, Rat testis, SH-SY5Y, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ACHA4 (P43681). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR | Uniprot ID | P43681 |
Uniprot Id
P43681
Target Species
Human
Target Name
CHRNA4
Target Full Name
Neuronal acetylcholine receptor subunit alpha-4
Target Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodium ions.
Target Involvement
Epilepsy, nocturnal frontal lobe, 1 (ENFL1)
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cell membrane; Lipid-anchor.
Target Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-4/CHRNA4 sub-subfamily
Target Synonyms
A4 nicotinic receptor; Acetylcholine receptor alpha 4 neural; Acetylcholine receptor neuronal nicotinic alpha 4 subunit; ACH 4; ACH4; ACHA4_HUMAN; AChR; Acra 4; Acra4; Alpha4 nAChR; BFNC; Cholinergic receptor nicotinic alpha 4; Cholinergic receptor nicotinic alpha polypeptide 4; CHRNA 4; CHRNA4; EBN 1; EBN; EBN1; NACHR; NACRA 4; NACRA4; Neuronal acetylcholine receptor subunit alpha-4; Neuronal nicotinic acetylcholine receptor alpha 4 subunit
Target Background
This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Alternative splicing results in multiple transcript variants.
Notification