-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALDH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ALDH2 (P05091) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ALDH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ALDH2 (P05091) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16007A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALDH2 |
| Target Synonyms | ALDM; ALDHI; ALDH-E2; ALDH2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, Mouse brain, Mouse liver, Rat liver, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ALDH2 (P05091). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPAL | Uniprot ID | P05091 |
Uniprot Id
P05091
Target Species
Human
Target Name
ALDH2
Target Full Name
Aldehyde dehydrogenase, mitochondrial
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Aldehyde dehydrogenase family
Target Synonyms
Acetaldehyde dehydrogenase 2; Aldehyde dehydrogenase 2 family (mitochondrial); Aldehyde dehydrogenase 2 family; Aldehyde dehydrogenase mitochondrial; Aldehyde dehydrogenase; mitochondrial; ALDH 2; ALDH class 2; ALDH E2; ALDH-E2; Aldh2; ALDH2_HUMAN; ALDHI; ALDM; Liver mitochondrial ALDH; MGC1806; Mitochondrial aldehyde dehydrogenase 2; MS767; Nucleus encoded mitochondrial aldehyde dehydrogenase 2
Target Background
This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of East Asians have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among East Asians than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification