-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AMHR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-144 of human AMHR2 (NP_065434.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AMHR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-144 of human AMHR2 (NP_065434.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15114A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AMHR2 |
| Target Synonyms | AMHR; MRII; MISR2; MISRII; AMHR2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 18-144 of human AMHR2 (NP_065434.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES | Uniprot ID | Q16671 |
Uniprot Id
Q16671
Target Species
Human
Target Name
AMHR2
Target Full Name
Anti-Muellerian hormone type-2 receptor
Target Function
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for anti-Muellerian hormone.
Target Involvement
Persistent Muellerian duct syndrome 2 (PMDS2)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Target Synonyms
AMH type II receptor; AMHR; AMHR2; AMHR2_HUMAN; Anti Mullerian hormone receptor; type II; Anti-Muellerian hormone type II receptor; Anti-Muellerian hormone type-2 receptor; MGC141312; MIS type II receptor; MISR2; MISRII; MRII; Muellerian hormone type 2 receptor; Muellerian hormone type II receptor; Muellerian inhibiting substance type II receptor; Mullerian hormone receptor type II; Mullerian inhibiting substance type II receptor
Target Background
This gene encodes the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
Notification