-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Annexin A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Annexin A2 (P07355) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Annexin A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Annexin A2 (P07355) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16843A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Annexin A2 |
| Target Synonyms | P36; ANX2; LIP2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; HEL-S-270; Annexin A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, MCF7, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Annexin A2 (P07355). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVIL | Uniprot ID | P07355 |
Uniprot Id
P07355
Target Species
Human
Target Name
ANXA2
Target Full Name
Annexin A2
Target Function
Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix, basement membrane. Melanosome. Note=In the lamina beneath the plasma membrane. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Translocated from the cytoplasm to the cell surface through a Golgi-independent mechanism.
Target Protein Families
Annexin family
Target Research Area
Signal Transduction
Target Synonyms
Annexin A2; Annexin II; Annexin II; heavy chain; Annexin-2; ANX 2; ANX2; ANX2L4; ANXA2; ANXA2_HUMAN; arylsulfatase B; CAL1H; Calpactin I heavy chain; calpactin I heavy polypeptide (p36); Calpactin I heavy polypeptide; Calpactin-1 heavy chain; chromobindin 8 ; Chromobindin-8; Epididymis secretory protein Li 270; HEL S 270; LIP2; Lipocortin II; LPC2; LPC2D; p36; P36 protein ; PAP-IV; Placental anticoagulant protein IV; Protein I
Target Background
This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Annexin A2 expression has been found to correlate with resistance to treatment against various cancer forms.
Notification