-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ApoB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ApoB (P04114) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ApoB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ApoB (P04114) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16890A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APOB |
| Target Synonyms | FLDB; FCHL2; LDLCQ4; apoB-48; apoB-100; ApoB | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse plasma, Rat plasma | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ApoB (P04114). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEP | Uniprot ID | P04114 |
Uniprot Id
P04114
Target Species
Human
Target Name
APOB
Target Full Name
Apolipoprotein B-100
Target Function
Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Target Involvement
Hypobetalipoproteinemia, familial, 1 (FHBL1); Familial ligand-defective apolipoprotein B-100 (FDB)
Target Subcellular Location
Cytoplasm. Secreted. Lipid droplet.
Target Research Area
Epigenetics and Nuclear Signaling, Cardiovascular
Target Synonyms
Apo B 100; Apo B; Apo B-100; Apo B-48; Apo B100; Apo B48; ApoB 100 ; ApoB 48; APOB; APOB_HUMAN; Apolipoprotein B (including Ag(x) antigen); Apolipoprotein B 100; Apolipoprotein B 48; Apolipoprotein B; Apolipoprotein B-48; Apolipoprotein B100; Apolipoprotein B48; FLDB; LDLCQ4
Target Background
This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins (LDL), and is the ligand for the LDL receptor. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels.
Notification