Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATAD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATAD2 (Q6PL18) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATAD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATAD2 (Q6PL18) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14269A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATAD2 |
| Target Synonyms | ANCCA; CT137; PRO2000; ATAD2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, MCF7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATAD2 (Q6PL18). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGSSVKEVETYHRTRALRSLRKDAQNSSDSSFEKNVEITEQLA | Uniprot ID | Q6PL18 |
Uniprot Id
Q6PL18
Target Species
Human
Target Name
ATAD2
Target Full Name
ATPase family AAA domain-containing protein 2
Target Function
May be a transcriptional coactivator of the nuclear receptor ESR1 required to induce the expression of a subset of estradiol target genes, such as CCND1, MYC and E2F1. May play a role in the recruitment or occupancy of CREBBP at some ESR1 target gene promoters. May be required for histone hyperacetylation. Involved in the estrogen-induced cell proliferation and cell cycle progression of breast cancer cells.
Target Subcellular Location
Nucleus.
Target Protein Families
AAA ATPase family
Target Tissue Specificity
Highly expressed in estrogen receptor positive breast tumors and in osteosarcoma tumors.
Target Synonyms
AAA nuclear coregulator cancer-associated protein; AAA nuclear coregulator; cancer-associated; ANCCA; Atad2; ATAD2_HUMAN; ATPase family AAA domain containing 2; ATPase family AAA domain containing protein 2; ATPase family AAA domain-containing protein 2; CT137; DKFZp667N1320; L16; MGC131938; MGC142216; MGC29843; MGC5254; PRO2000
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
