Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Carbonic Anhydrase 2 (CA2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 161-260 of human Carbonic Anhydrase 2 (CA2) (P00918) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Carbonic Anhydrase 2 (CA2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 161-260 of human Carbonic Anhydrase 2 (CA2) (P00918) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15819A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Carbonic Anhydrase 2 (CA2) |
| Target Synonyms | CAC; CAII; Car2; CA-II; HEL-76; HEL-S-282; Carbonic Anhydrase 2 (CA2) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, Mouse brain, Mouse spinal cord, Rat spinal cord | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 161-260 of human Carbonic Anhydrase 2 (CA2) (P00918). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK | Uniprot ID | P00918 |
Uniprot Id
P00918
Target Species
Human
Target Name
CA2
Target Full Name
Carbonic anhydrase 2
Target Function
Essential for bone resorption and osteoclast differentiation. Reversible hydration of carbon dioxide. Can hydrate cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.
Target Involvement
Osteopetrosis, autosomal recessive 3 (OPTB3)
Target Subcellular Location
Cytoplasm. Cell membrane. Note=Colocalized with SLC26A6 at the surface of the cell membrane in order to form a bicarbonate transport metabolon. Displaced from the cytosolic surface of the cell membrane by PKC in phorbol myristate acetate (PMA)-induced cells.
Target Protein Families
Alpha-carbonic anhydrase family
Target Research Area
Signal Transduction
Target Synonyms
CA 2; CA II; CA-II; Ca2; CAC; CAH2_HUMAN; CAII; Car 2; Car2; Carbonate dehydratase II; Carbonic anhydrase 2; Carbonic anhydrase B; Carbonic anhydrase C; Carbonic anhydrase C; formerly; Carbonic anhydrase II; Carbonic dehydratase; epididymis luminal protein 76; Epididymis secretory protein Li 282; HEL-76; HEL-S-282
Target Background
The protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
