-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Casein Kinase 2 alpha (CSNK2A1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Casein Kinase 2 alpha (CSNK2A1) (P68400) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Casein Kinase 2 alpha (CSNK2A1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Casein Kinase 2 alpha (CSNK2A1) (P68400) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15799A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Casein Kinase 2 alpha (CSNK2A1) |
| Target Synonyms | CKII; Cka1; Cka2; CK2A1; OCNDS; [KD Validated] Casein Kinase 2 alpha (CSNK2A1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BT-474, SW620 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Casein Kinase 2 alpha (CSNK2A1) (P68400). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI | Uniprot ID | P68400 |
Uniprot Id
P68400
Target Species
Human
Target Name
CSNK2A1
Target Full Name
Casein kinase II subunit alpha
Target Function
Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, ATF4, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Mediates sequential phosphorylation of FNIP1, promoting its gradual interaction with Hsp90, leading to activate both kinase and non-kinase client proteins of Hsp90. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins. During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV. Phosphorylates PML at 'Ser-565' and primes it for ubiquitin-mediated degradation. Plays an important role in the circadian clock function by phosphorylating ARNTL/BMAL1 at 'Ser-90' which is pivotal for its interaction with CLOCK and which controls CLOCK nuclear entry. Phosphorylates CCAR2 at 'Thr-454' in gastric carcinoma tissue.
Target Involvement
Okur-Chung neurodevelopmental syndrome (OCNDS)
Target Subcellular Location
Nucleus.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily
Target Tissue Specificity
Expressed in gastric carcinoma tissue and the expression gradually increases with the progression of the carcinoma (at protein level).
Target Research Area
Signal Transduction
Target Synonyms
Casein kinase 2 alpha 1 polypeptide; Casein kinase II alpha 1; Casein kinase II alpha 1 subunit; Casein kinase II alpha subunit; Casein kinase II subunit alpha; CK II alpha; CK II; CK2 alpha; CK2 catalytic subunit alpha; CK2A1; CKII; CKIIalpha; CSK21_HUMAN; CSNK2A1
Target Background
Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythm. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. The protein encoded by this gene represents the alpha subunit. Multiple transcript variants encoding different protein isoforms have been found for this gene.
Notification