-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Casein Kinase 2 beta (CSNK2B) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (CSNK2B) (P67870) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Casein Kinase 2 beta (CSNK2B) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (CSNK2B) (P67870) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13878A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Casein Kinase 2 beta (CSNK2B) |
| Target Synonyms | G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B; POBINDS; Casein Kinase 2 beta (CSNK2B) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, K-562, Mouse spleen, Mouse testis, Rat testis, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (CSNK2B) (P67870). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR | Uniprot ID | P67870 |
Uniprot Id
P67870
Target Species
Human
Target Name
CSNK2B
Target Full Name
Casein kinase II subunit beta
Target Function
Regulatory subunit of casein kinase II/CK2. As part of the kinase complex regulates the basal catalytic activity of the alpha subunit a constitutively active serine/threonine-protein kinase that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Participates in Wnt signaling.
Target Protein Families
Casein kinase 2 subunit beta family
Target Research Area
Signal Transduction
Target Synonyms
Casein kinase 2 beta polypeptide; Casein kinase II beta subunit; Casein kinase II subunit beta; CK II beta; CK2B; CK2N; CSK2B; CSK2B_HUMAN; CSNK 2B; csnk2b; G5A; MGC138222; MGC138224; Phosvitin; Protein G5a
Target Background
This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.
Notification