-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Caspase-6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Caspase-6 (P55212) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Caspase-6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Caspase-6 (P55212) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13601A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Caspase-6 |
| Target Synonyms | MCH2; CSP-6; caspase-6; Caspase-6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Caspase-6 (P55212). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTL | Uniprot ID | P55212 |
Uniprot Id
P55212
Target Species
Human
Target Name
CASP6
Target Full Name
Caspase-6
Target Function
Cysteine protease that plays essential roles in programmed cell death, axonal degeneration, development and innate immunity. During apoptosis, localizes in the nucleus and cleaves the nuclear structural protein NUMA1 and lamin A/LMNA thereby inducing nuclear shrinkage and fragmentation. Furthermore, cleaves many transcription factors such as NF-kappa-B and cAMP response element-binding protein/CREBBP. Cleaves phospholipid scramblase proteins XKR4 and XKR9. Plays an essential role in axon degeneration during axon pruning which is the remodeling of axons during neurogenesis but not apoptosis. Regulates B-cell programs both during early development and after antigen stimulation. In addition, promotes the ZBP1-mediated activation of programmed cell death pathways including pyroptosis, apoptosis, and necroptosis (PANoptosis) and plays an essential role in defense against viruses. Mechanistically, interacts with RIPK3 and enhances the interaction between RIPK3 and ZBP1, leading to ZBP1-mediated inflammasome activation and cell death.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Peptidase C14A family
Target Synonyms
Apoptotic protease Mch-2; Apoptotic protease MCH2; CASP-6; CASP6; CASP6_HUMAN; Caspase 6; Caspase 6 apoptosis related cysteine protease; Caspase 6; apoptosis related cysteine peptidase; Caspase-6; Caspase-6 subunit p11; Mch2; OTTHUMP00000162742; OTTHUMP00000162743
Target Background
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms.
Notification