-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD27 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD27 (P26842) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CD27 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD27 (P26842) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16176A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD27 |
| Target Synonyms | T14; S152; Tp55; TNFRSF7; S152. LPFS2; CD27 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat thymus, THP-1 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD27 (P26842). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITA | Uniprot ID | P26842 |
Uniprot Id
P26842
Target Species
Human
Target Name
CD27
Target Full Name
CD27 antigen
Target Function
Receptor for CD70/CD27L. May play a role in survival of activated T-cells. May play a role in apoptosis through association with SIVA1.
Target Involvement
Lymphoproliferative syndrome 2 (LPFS2)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Found in most T-lymphocytes.
Target Synonyms
CD27; TNFRSF7; CD27 antigen; CD27L receptor; T-cell activation antigen CD27; T14; Tumor necrosis factor receptor superfamily member 7; CD antigen CD27
Target Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.
Notification