Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD58 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD58 (P19256) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD58 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD58 (P19256) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15853A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD58 |
| Target Synonyms | ag3; LFA3; LFA-3; CD58 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD58 (P19256). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDE | Uniprot ID | P19256 |
Uniprot Id
P19256
Target Species
Human
Target Name
CD58
Target Full Name
Lymphocyte function-associated antigen 3
Target Function
Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.
Target Synonyms
CD58; LFA3; Lymphocyte function-associated antigen 3; Ag3; Surface glycoprotein LFA-3; CD antigen CD58
Target Background
This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
