-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD99 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD99 (NP_002405.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD99 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD99 (NP_002405.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14591A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD99 |
| Target Synonyms | MIC2; HBA71; MIC2X; MIC2Y; MSK5X; CD99 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD99 (NP_002405.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVS | Uniprot ID | P14209 |
Uniprot Id
P14209
Target Species
Human
Target Name
CD99
Target Full Name
CD99 antigen
Target Function
Involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. Plays a role in a late step of leukocyte extravasation helping leukocytes to overcome the endothelial basement membrane. Acts at the same site as, but independently of, PECAM1. Involved in T-cell adhesion processes.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
CD99 family
Target Synonyms
CD99; MIC2; MIC2X; MIC2Y; CD99 antigen; 12E7; E2 antigen; Protein MIC2; T-cell surface glycoprotein E2; CD antigen CD99
Target Background
The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus.
Notification