-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDC25B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CDC25B (P30305) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CDC25B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CDC25B (P30305) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16654A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDC25B |
| Target Synonyms | CDC25B; cell division cycle 25B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Hep G2, Raji | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CDC25B (P30305). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFK | Uniprot ID | P30305 |
Uniprot Id
P30305
Target Species
Human
Target Name
CDC25B
Target Full Name
M-phase inducer phosphatase 2
Target Function
Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Directly dephosphorylates CDK1 and stimulates its kinase activity. The three isoforms seem to have a different level of activity.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole.
Target Protein Families
MPI phosphatase family
Target Synonyms
AI604853 ; Cdc 25B; Cdc25b; CDC25HU2; Cdc25m2; Cell division cycle 25 homolog B; Cell division cycle 25B; Cell division cycle 25B isoform 1; Cell division cycle 25B isoform 2; Cell division cycle 25B isoform 3; Cell division cycle 25B isoform 4; Cell division cycle 25B isoform 5; Dual specificity phosphatase Cdc25B; EC 3.1.3.48; M phase inducer phosphatase 2; M-phase inducer phosphatase 2; MPIP2_HUMAN
Target Background
CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. Multiple transcript variants for this gene exist.
Notification