-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COL11A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 301-400 of human COL11A1 mAb (NP_001845.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against COL11A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 301-400 of human COL11A1 mAb (NP_001845.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15534A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COL11A1 |
| Target Synonyms | STL2; COLL6; CO11A1; DFNA37; COL11A1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 40% Glycerol., 0.05% BSA, 59% PBS with 0.01% Sodium azide, PH 7.2 | Purification Method | Affinity purification |
| Positive Samples | A-204, U-2 OS(Low expression control) | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 301-400 of human COL11A1 mAb (NP_001845.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEE | Uniprot ID | P12107 |
Uniprot Id
P12107
Target Species
Human
Target Name
COL11A1
Target Full Name
Collagen alpha-1(XI) chain
Target Function
May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.
Target Involvement
Stickler syndrome 2 (STL2); Marshall syndrome (MRSHS); Fibrochondrogenesis 1 (FBCG1)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Fibrillar collagen family
Target Tissue Specificity
Cartilage, placenta and some tumor or virally transformed cell lines. Isoforms using exon IIA or IIB are found in the cartilage while isoforms using only exon IIB are found in the tendon.
Target Research Area
Others
Target Synonyms
COBA1_HUMAN; COL11A1; COLL6; Collagen alpha 1; Collagen alpha-1(XI) chain; collagen XI alpha 1; collagen XI; alpha 1 polypeptide ; collagen; type XI; alpha 1; STL2; STL3; XI chain precursor
Target Background
This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. Type XI collagen is a heterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Mutations in this gene are associated with type II Stickler syndrome and with Marshall syndrome. A single-nucleotide polymorphism in this gene is also associated with susceptibility to lumbar disc herniation. Multiple transcript variants have been identified for this gene.
Notification