Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Contactin 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Contactin 2 (Q02246) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Contactin 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Contactin 2 (Q02246) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14160A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Contactin 2 |
| Target Synonyms | AXT; TAX; TAX1; FAME5; TAG-1; Contactin 2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, A-549, Mouse brain, Mouse lung, Mouse spinal cord, SH-SY5Y, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Contactin 2 (Q02246). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGTATRRKPHLLLVAAVALVSSSAWSSALGSQTTFGPVFEDQPLSVLFPEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNP | Uniprot ID | Q02246 |
Uniprot Id
Q02246
Target Species
Human
Target Name
CNTN2
Target Full Name
Contactin-2
Target Function
In conjunction with another transmembrane protein, CNTNAP2, contributes to the organization of axonal domains at nodes of Ranvier by maintaining voltage-gated potassium channels at the juxtaparanodal region. May be involved in cell adhesion.
Target Involvement
Epilepsy, familial adult myoclonic, 5 (FAME5)
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Note=Attached to the neuronal membrane by a GPI-anchor and is also released from neurons.
Target Protein Families
Immunoglobulin superfamily, Contactin family
Target Synonyms
AXT; TAX; TAX1; FAME5; TAG-1; Contactin 2
Target Background
This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. The encoded glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein plays a role in the proliferation, migration, and axon guidance of neurons of the developing cerebellum. A mutation in this gene may be associated with adult myoclonic epilepsy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
