-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COX7A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-79 of human COX7A1 (NP_001855.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against COX7A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-79 of human COX7A1 (NP_001855.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14612A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COX7A1 |
| Target Synonyms | COX7A; COX7AH; COX7AM; COX7A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, 293T, A549, Rat skeletal muscle | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-79 of human COX7A1 (NP_001855.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN | Uniprot ID | P24310 |
Uniprot Id
P24310
Target Species
Human
Target Name
COX7A1
Target Full Name
Cytochrome c oxidase subunit 7A1, mitochondrial
Target Function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Target Protein Families
Cytochrome c oxidase VIIa family
Target Synonyms
COX7A; COX7A1; COX7AH; COX7AM; CX7A1_HUMAN; Cytochrome c oxidase subunit 7A1; Cytochrome c oxidase subunit 7A1 mitochondrial; Cytochrome c oxidase subunit VIIa H; Cytochrome c oxidase subunit VIIa heart; Cytochrome c oxidase subunit VIIa heart/muscle isoform; Cytochrome c oxidase subunit VIIa M; Cytochrome c oxidase subunit VIIa muscle; Cytochrome c oxidase subunit VIIa polypeptide 1 (muscle); Cytochrome c oxidase subunit VIIa polypeptide 1; Cytochrome c oxidase subunit VIIa-H; Cytochrome c oxidase subunit VIIa-heart; Cytochrome c oxidase subunit VIIa-M; Cytochrome c oxidase subunit VIIa-muscle; mitochondrial
Target Background
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes.
Notification