-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CtBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-440 of human CtBP1 (Q13363) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CtBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-440 of human CtBP1 (Q13363) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16010A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CTBP1 |
| Target Synonyms | BARS; HADDTS; CtBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Jurkat, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 301-440 of human CtBP1 (Q13363). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATHWASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL | Uniprot ID | Q13363 |
Uniprot Id
Q13363
Target Species
Human
Target Name
CTBP1
Target Full Name
C-terminal-binding protein 1
Target Function
Corepressor targeting diverse transcription regulators such as GLIS2 or BCL6. Has dehydrogenase activity. Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex. Functions in brown adipose tissue (BAT) differentiation.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
D-isomer specific 2-hydroxyacid dehydrogenase family
Target Tissue Specificity
Expressed in germinal center B-cells.
Target Synonyms
BARS; brefeldin A- ribosylated substrate; C terminal binding protein 1; C-terminal-binding protein 1; CTBP; CtBP1; CTBP1_HUMAN; MGC104684
Target Background
This gene encodes a protein that binds to the C-terminus of adenovirus E1A proteins. This phosphoprotein is a transcriptional repressor and may play a role during cellular proliferation. This protein and the product of a second closely related gene, CTBP2, can dimerize. Both proteins can also interact with a polycomb group protein complex which participates in regulation of gene expression during development. Alternative splicing of transcripts from this gene results in multiple transcript variants.
Notification