-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCP1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 483-582 of human DCP1A (Q9NPI6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DCP1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 483-582 of human DCP1A (Q9NPI6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16112A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCP1A |
| Target Synonyms | SMIF; SMAD4IP1; HSA275986; Nbla00360; DCP1A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, HepG2, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 483-582 of human DCP1A (Q9NPI6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL | Uniprot ID | Q9NPI6 |
Uniprot Id
Q9NPI6
Target Species
Human
Target Name
DCP1A
Target Full Name
mRNA-decapping enzyme 1A
Target Function
Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Contributes to the transactivation of target genes after stimulation by TGFB1. Essential for embryonic development.
Target Subcellular Location
Cytoplasm, P-body. Nucleus.
Target Protein Families
DCP1 family
Target Tissue Specificity
Detected in heart, brain, placenta, lung, skeletal muscle, liver, kidney and pancreas.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
DCP1 decapping enzyme homolog A; Dcp1a; DCP1A_HUMAN; Decapping enzyme hDcp1a; Decapping mRNA 1A; HSA275986; mRNA decapping enzyme 1A; mRNA-decapping enzyme 1A; Nbla00360; Putative protein product of Nbla00360; Smad4 interacting transcriptional co activator ; Smad4-interacting transcriptional co-activator ; Smad4-interacting transcriptional co-activator; SMAD4IP1; SMIF; Transcription factor SMIF
Target Background
Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. Alternative splicing of this gene results in multiple transcript variants.
Notification