Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNAJC12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 99-198 of human DNAJC12 (Q9UKB3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DNAJC12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 99-198 of human DNAJC12 (Q9UKB3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13318A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNAJC12 |
| Target Synonyms | JDP1; HPANBH4; DNAJC12 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 99-198 of human DNAJC12 (Q9UKB3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSMHWVVRGKKDLMLEESDKTHTTKMENEECNEQRERKKEELASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYEI | Uniprot ID | Q9UKB3 |
Uniprot Id
Q9UKB3
Target Species
Human
Target Name
DNAJC12
Target Full Name
DnaJ homolog subfamily C member 12
Target Involvement
Hyperphenylalaninemia, mild, non-BH4-deficient (HPANBH4)
Target Subcellular Location
[Isoform a]: Cytoplasm.
Target Tissue Specificity
Expressed at high levels in brain, heart, and testis, and at reduced levels in kidney and stomach.
Target Synonyms
DJC12_HUMAN; DnaJ (Hsp40) homolog subfamily C member 12; DnaJ heat shock protein family (Hsp40) member C12; DnaJ homolog subfamily C member 12; DnaJ/Hsp40 homolog; subfamily C; member 12; DNAJC12; HPANBH4; J domain containing protein 1 (JDP1); J domain containing protein 1; J domain protein 1; J domain-containing protein 1; JDP1; mJDP1; RP11-57G10.2
Target Background
This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
