-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DP1/TFDP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 311-410 of human DP1/TFDP1 (Q14186) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against DP1/TFDP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 311-410 of human DP1/TFDP1 (Q14186) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13961A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DP1/TFDP1 |
| Target Synonyms | DP1; DILC; Dp-1; DRTF1; DP1/TFDP1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Raji, RD | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 311-410 of human DP1/TFDP1 (Q14186). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGSCSAEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTAGSTSNGTRFSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDEDD | Uniprot ID | Q14186 |
Uniprot Id
Q14186
Target Species
Human
Target Name
TFDP1
Target Full Name
Transcription factor Dp-1
Target Function
Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The E2F1:DP complex appears to mediate both cell proliferation and apoptosis. Blocks adipocyte differentiation by repressing CEBPA binding to its target gene promoters.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
E2F/DP family
Target Tissue Specificity
Highest levels in muscle. Also expressed in brain, placenta, liver and kidney. Lower levels in lung and pancreas. Not detected in heart.
Target Synonyms
DP 1; DP1; DRTF1; DRTF1-polypeptide 1; E2F dimerization partner 1; E2F related transcription factor; TFDP1; TFDP1_HUMAN; Transcription factor Dp-1; Transcription factor sequence-specific, DRTF1
Target Background
This gene encodes a member of a family of transcription factors that heterodimerize with E2F proteins to enhance their DNA-binding activity and promote transcription from E2F target genes. The encoded protein functions as part of this complex to control the transcriptional activity of numerous genes involved in cell cycle progression from G1 to S phase. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1, 15, and X.
Notification