-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Endo G was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 198-297 of human Endo G (Q14249) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Endo G was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 198-297 of human Endo G (Q14249) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13987A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Endo G |
| Target Synonyms | ENDOG; endonuclease G; Endo G | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Mouse liver, Rat liver, Rat skeletal muscle, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 198-297 of human Endo G (Q14249). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGSK | Uniprot ID | Q14249 |
Uniprot Id
Q14249
Target Species
Human
Target Name
ENDOG
Target Full Name
Endonuclease G, mitochondrial
Target Function
Endonuclease that preferentially catalyzes the cleavage of double-stranded 5-hydroxymethylcytosine (5hmC)-modified DNA. The 5hmC-modified nucleotide does not increase the binding affinity, but instead increases the efficiency of cutting and specifies the site of cleavage for the modified DNAs. Shows significantly higher affinity for four-stranded Holliday junction over duplex and single-stranded DNAs. Promotes conservative recombination when the DNA is 5hmC-modified. Promotes autophagy through the suppression of mTOR by its phosphorylation-mediated interaction with YWHAG and its endonuclease activity-mediated DNA damage response. GSK3-beta mediated phosphorylation of ENDOG enhances its interaction with YWHAG, leading to the release of TSC2 and PIK3C3 from YWHAG resulting in mTOR pathway suppression and autophagy initiation. Promotes cleavage of mtDNA in response to oxidative and nitrosative stress, in turn inducing compensatory mtDNA replication.
Target Subcellular Location
Mitochondrion.
Target Protein Families
DNA/RNA non-specific endonuclease family
Target Synonyms
ENDOG; Endonuclease G; mitochondrial; Endo G; EC 3.1.30.-
Target Background
The protein encoded by this gene is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein is widely distributed among animals and cleaves DNA at GC tracts. This protein is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.
Notification