Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ENDOGL1 / ENGL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 269-368 of human ENDOGL1 / ENGL (Q9Y2C4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ENDOGL1 / ENGL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 269-368 of human ENDOGL1 / ENGL (Q9Y2C4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13487A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ENDOGL1 / ENGL |
| Target Synonyms | ENGL; ENGLA; ENGLB; ENGL-a; ENGL-b; ENDOGL1; ENDOGL2; ENDOGL1 / ENGL | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, HUVEC, MCF7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 269-368 of human ENDOGL1 / ENGL (Q9Y2C4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS | Uniprot ID | Q9Y2C4 |
Uniprot Id
Q9Y2C4
Target Species
Human
Target Name
EXOG
Target Full Name
Nuclease EXOG, mitochondrial
Target Function
Endo/exonuclease with nicking activity towards supercoiled DNA, a preference for single-stranded DNA and 5'-3' exonuclease activity.
Target Subcellular Location
Mitochondrion inner membrane.
Target Protein Families
DNA/RNA non-specific endonuclease family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Endo G like 1; Endo G-like 1; Endo/exonuclease (5'-3'); endonuclease G like; ENDOGL 1; ENDOGL1; ENDOGL2; Endonuclease G like 1; Endonuclease G like 2; Endonuclease G-like 1; ENGL a; ENGL; ENGL B; ENGLA; ENGLB; Exog; EXOG_HUMAN; MGC125944; MGC125945; mitochondrial; Nuclease EXOG; Nuclease EXOG mitochondrial
Target Background
This gene encodes an endo/exonuclease with 5'-3' exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5' end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell death. Alternatively spliced transcript variants have been described. A pseudogene exists on chromosome 18.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
