-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Epac1/RAPGEF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 824-923 of human Epac1/RAPGEF3 (O95398) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Epac1/RAPGEF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 824-923 of human Epac1/RAPGEF3 (O95398) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13829A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Epac1/RAPGEF3 |
| Target Synonyms | EPAC; Epac1/RAPGEF3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Epac1/RAPGEF3 (O95398). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP | Uniprot ID | O95398 |
Uniprot Id
O95398
Target Species
Human
Target Name
RAPGEF3
Target Full Name
Rap guanine nucleotide exchange factor 3
Target Function
Guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP. Through simultaneous binding of PDE3B to RAPGEF3 and PIK3R6 is assembled in a signaling complex in which it activates the PI3K gamma complex and which is involved in angiogenesis. Plays a role in the modulation of the cAMP-induced dynamic control of endothelial barrier function through a pathway that is independent on Rho-mediated signaling. Required for the actin rearrangement at cell-cell junctions, such as stress fibers and junctional actin.
Target Subcellular Location
Endomembrane system.
Target Tissue Specificity
Widely expressed with highest levels in adult kidney, heart, thyroid and brain, and fetal kidney.
Target Synonyms
RAPGEF3; CGEF1; EPAC; EPAC1; Rap guanine nucleotide exchange factor 3; Exchange factor directly activated by cAMP 1; Exchange protein directly activated by cAMP 1; EPAC 1; Rap1 guanine-nucleotide-exchange factor directly activated by cAMP; cAMP-regulated guanine nucleotide exchange factor I; cAMP-GEFI
Target Background
Enables guanyl-nucleotide exchange factor activity and protein domain specific binding activity. Involved in several processes, including positive regulation of protein modification process; regulation of actin cytoskeleton organization; and regulation of syncytium formation by plasma membrane fusion. Located in filopodium; lamellipodium; and microvillus. Colocalizes with cortical actin cytoskeleton and plasma membrane. Biomarker of congestive heart failure.
Notification