-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Exportin 2 (XPO2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 872-971 of human Exportin 2 (XPO2) (P55060) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Exportin 2 (XPO2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 872-971 of human Exportin 2 (XPO2) (P55060) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14112A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Exportin 2 (XPO2) |
| Target Synonyms | CAS; CSE1; XPO2; Exportin 2 (XPO2) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, Mouse testis, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 872-971 of human Exportin 2 (XPO2) (P55060). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL | Uniprot ID | P55060 |
Uniprot Id
P55060
Target Species
Human
Target Name
CSE1L
Target Full Name
Exportin-2
Target Function
Export receptor for importin-alpha. Mediates importin-alpha re-export from the nucleus to the cytoplasm after import substrates (cargos) have been released into the nucleoplasm. In the nucleus binds cooperatively to importin-alpha and to the GTPase Ran in its active GTP-bound form. Docking of this trimeric complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the importin-alpha from the export receptor. CSE1L/XPO2 then return to the nuclear compartment and mediate another round of transport. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
XPO2/CSE1 family
Target Tissue Specificity
Detected in brain, placenta, ovary, testis and trachea (at protein level). Widely expressed. Highly expressed in testis and in proliferating cells.
Target Synonyms
CSE1L; CAS; XPO2; Exportin-2; Exp2; Cellular apoptosis susceptibility protein; Chromosome segregation 1-like protein; Importin-alpha re-exporter
Target Background
Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. Alternatively spliced transcript variants have been found for this gene.
Notification