-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Exportin 5 (XPO5) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Exportin 5 (XPO5) (Q9HAV4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Exportin 5 (XPO5) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Exportin 5 (XPO5) (Q9HAV4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13813A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Exportin 5 (XPO5) |
| Target Synonyms | exp5; Exportin 5 (XPO5) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, MCF7, U-2 OS | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Exportin 5 (XPO5) (Q9HAV4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEKCPICVPCGLRLAEKTQVAIVRHFGLQILEHVVKFRWNGMSRLEKVYLKNSVMELIANGTLNILEEENHIKDALSRIVVEMIKREWPQHWPDMLIELDTLSKQGETQTELVMFILLRLAEDVVTFQTLPPQRRRDIQQTLTQNMERIFSFLLNTLQEN | Uniprot ID | Q9HAV4 |
Uniprot Id
Q9HAV4
Target Species
Human
Target Name
XPO5
Target Full Name
Exportin-5
Target Function
Mediates the nuclear export of proteins bearing a double-stranded RNA binding domain (dsRBD) and double-stranded RNAs (cargos). XPO5 in the nucleus binds cooperatively to the RNA and to the GTPase Ran in its active GTP-bound form. Proteins containing dsRBDs can associate with this trimeric complex through the RNA. Docking of this complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause disassembly of the complex and release of the cargo from the export receptor. XPO5 then returns to the nuclear compartment by diffusion through the nuclear pore complex, to mediate another round of transport. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Overexpression may in some circumstances enhance RNA-mediated gene silencing (RNAi). Mediates nuclear export of isoform 5 of ADAR/ADAR1 in a RanGTP-dependent manner.; Mediates the nuclear export of micro-RNA precursors, which form short hairpins. Also mediates the nuclear export of synthetic short hairpin RNAs used for RNA interference. In some circumstances can also mediate the nuclear export of deacylated and aminoacylated tRNAs. Specifically recognizes dsRNAs that lack a 5'-overhang in a sequence-independent manner, have only a short 3'-overhang, and that have a double-stranded length of at least 15 base-pairs. Binding is dependent on Ran-GTP.; (Microbial infection) Mediates the nuclear export of adenovirus VA1 dsRNA
Target Subcellular Location
Nucleus. Cytoplasm. Note=Shuttles between the nucleus and the cytoplasm.
Target Protein Families
Exportin family
Target Tissue Specificity
Expressed in heart, brain, placenta, lung, skeletal muscle, kidney and pancreas.
Target Synonyms
Exp 5; Exp5; Exportin 5; Exportin-5; Exportin5; FLJ14239; FLJ32057; FLJ45606; KIAA1291; OTTHUMP00000016472; Ran binding protein 21; Ran-binding protein 21; Ranbp 21; Ranbp21; Xpo 5; xpo5; XPO5_HUMAN
Target Background
This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.
Notification