-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Ferritin Heavy Chain was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ferritin Heavy Chain (P02794) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Ferritin Heavy Chain was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ferritin Heavy Chain (P02794) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17149A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Ferritin Heavy Chain |
| Target Synonyms | FHC; FTH; HFE5; PLIF; FTHL6; PIG15; Ferritin Heavy Chain | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Mouse brain, Rat liver, U-251 MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ferritin Heavy Chain (P02794). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNA | Uniprot ID | P02794 |
Uniprot Id
P02794
Target Species
Human
Target Name
FTH1
Target Full Name
Ferritin heavy chain
Target Function
Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.
Target Involvement
Hemochromatosis 5 (HFE5)
Target Protein Families
Ferritin family
Target Tissue Specificity
Expressed in the liver.
Target Research Area
Metabolism
Target Synonyms
Apoferritin; Cell proliferation inducing gene 15 protein; Cell proliferation-inducing gene 15 protein; F HC; Ferritin H subunit; Ferritin heavy chain; Ferritin heavy polypeptide 1; FHC; FRIH; FRIH_HUMAN; FTH 1; FTH; FTH1; FTH1 protein; FTHL 6; FTHL6; Iron overload autosomal dominant; MGC104426; N-terminally processed; OK/SW-cl.84; PIG 15; PIG15; Placenta immunoregulatory factor; PLIF; Proliferation inducing gene 15 protein; Proliferation inducing protein 15
Target Background
This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined.
Notification