Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FRAT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-170 of human FRAT1 (NP_005470.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against FRAT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-170 of human FRAT1 (NP_005470.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of HeLa cells using FRAT1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-13351A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FRAT1 |
| Target Synonyms | FRAT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-170 of human FRAT1 (NP_005470.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGRVRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRR | Uniprot ID | Q92837 |
Uniprot Id
Q92837
Target Species
Human
Target Name
FRAT1
Target Full Name
Proto-oncogene FRAT1
Target Function
Positively regulates the Wnt signaling pathway by stabilizing beta-catenin through the association with GSK-3. May play a role in tumor progression and collaborate with PIM1 and MYC in lymphomagenesis.
Target Subcellular Location
Cytoplasm.
Target Protein Families
GSK-3-binding protein family
Target Synonyms
FRAT1Proto-oncogene FRAT1; Frequently rearranged in advanced T-cell lymphomas 1; FRAT-1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
