-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GARS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 640-739 of human GARS (P41250) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GARS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 640-739 of human GARS (P41250) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17174A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GARS |
| Target Synonyms | GARS; HMN5; CMT2D; DSMAV; GlyRS; HMN5A; SMAD1; SMAJI; RS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Hep G2, Jurkat, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 640-739 of human GARS (P41250). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE | Uniprot ID | P41250 |
Uniprot Id
P41250
Target Species
Human
Target Name
GARS1
Target Full Name
Glycine--tRNA ligase
Target Function
Catalyzes the ATP-dependent ligation of glycine to the 3'-end of its cognate tRNA, via the formation of an aminoacyl-adenylate intermediate (Gly-AMP). Also produces diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs. Thereby, may play a special role in Ap4A homeostasis.
Target Involvement
Charcot-Marie-Tooth disease 2D (CMT2D); Neuronopathy, distal hereditary motor, 5A (HMN5A)
Target Subcellular Location
Cytoplasm. Cell projection, axon. Secreted. Secreted, extracellular exosome.; [Isoform 1]: Mitochondrion. Cytoplasm.; [Isoform 2]: Cytoplasm. Cell projection, axon.
Target Protein Families
Class-II aminoacyl-tRNA synthetase family
Target Tissue Specificity
Widely expressed, including in brain and spinal cord.; [Isoform 2]: Expressed in brain, spinal cord, muscle, heart and spleen.; [Isoform 1]: Expressed in brain, spinal cord, muscle, heart, spleen and liver.
Target Synonyms
GARS1; GARSGlycine--tRNA ligase; EC 6.1.1.14; Diadenosine tetraphosphate synthetase; Ap4A synthetase; EC 2.7.7.-; Glycyl-tRNA synthetase; GlyRS; Glycyl-tRNA synthetase 1
Target Background
This gene encodes glycyl-tRNA synthetase, one of the aminoacyl-tRNA synthetases that charge tRNAs with their cognate amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Two transcript variants encoding different isoforms have been found for this gene.
Notification