-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Glyt2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Glyt2 (Q9Y345) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Glyt2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Glyt2 (Q9Y345) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13323A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Glyt2 |
| Target Synonyms | NET1; GLYT2; HKPX3; GLYT-2; Glyt2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse lung, Mouse spinal cord, Rat spinal cord, SH-SY5Y, U-937 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Glyt2 (Q9Y345). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTA | Uniprot ID | Q9Y345 |
Uniprot Id
Q9Y345
Target Species
Human
Target Name
SLC6A5
Target Full Name
Sodium- and chloride-dependent glycine transporter 2
Target Function
Sodium- and chloride-dependent glycine transporter. Terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. May be responsible for the termination of neurotransmission at strychnine-sensitive glycinergic synapses.
Target Involvement
Hyperekplexia 3 (HKPX3)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A5 subfamily
Target Tissue Specificity
Expressed in medulla, and to a lesser extent in spinal cord and cerebellum.
Target Synonyms
Glycine transporter; Glycine transporter type 2; GlyT-2; GlyT2; NET1; SC6A5_HUMAN; SC6AC5; Slc6a5; SLC6A5 solute carrier family 6 neurotransmitter transporter, glycine member 5; Slc6a9; Sodium and chloride dependent glycine transporter 2; Sodium- and chloride-dependent glycine transporter 2; Solute carrier family 6 member 5; Solute carrier family 6 neurotransmitter transporter glycine member 5
Target Background
This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea. Two transcript variants encoding different isoforms have been found for this gene.
Notification