-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GTPBP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-92 of human GTPBP4 (Q9BZE4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GTPBP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-92 of human GTPBP4 (Q9BZE4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13898A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GTPBP4 |
| Target Synonyms | NGB; CRFG; NOG1; GTPBP4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-92 of human GTPBP4 (Q9BZE4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNILYDKDHY | Uniprot ID | Q9BZE4 |
Uniprot Id
Q9BZE4
Target Species
Human
Target Name
GTPBP4
Target Full Name
GTP-binding protein 4
Target Function
Involved in the biogenesis of the 60S ribosomal subunit.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
TRAFAC class OBG-HflX-like GTPase superfamily, OBG GTPase family, NOG subfamily
Target Synonyms
Chronic renal failure gene protein; CRFG ; G protein binding protein CRFG; GTP binding protein 4; GTP-binding protein NGB; Gtpbp4; NGB ; NOG1 ; NOG1_HUMAN; Nucleolar GTP binding protein 1; Nucleolar GTP-binding protein 1
Target Background
GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and inactive, when GDP is bound. 'Active' in this context usually means that the molecule acts as a signal to trigger other events in the cell. When an extracellular ligand binds to a G-protein-linked receptor, the receptor changes its conformation and switches on the trimeric G proteins that associate with it by causing them to eject their GDP and replace it with GTP. The switch is turned off when the G protein hydrolyzes its own bound GTP, converting it back to GDP. But before that occurs, the active protein has an opportunity to diffuse away from the receptor and deliver its message for a prolonged period to its downstream target.
Notification