Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Hemopexin (HPX) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 363-462 of human Hemopexin (HPX) (P02790) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Hemopexin (HPX) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 363-462 of human Hemopexin (HPX) (P02790) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14021A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Hemopexin (HPX) |
| Target Synonyms | HX; Hemopexin (HPX) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | human serum, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 363-462 of human Hemopexin (HPX) (P02790). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH | Uniprot ID | P02790 |
Uniprot Id
P02790
Target Species
Human
Target Name
HPX
Target Full Name
Hemopexin
Target Function
Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation.
Target Subcellular Location
Secreted.
Target Protein Families
Hemopexin family
Target Tissue Specificity
Expressed by the liver and secreted in plasma.
Target Synonyms
Beta 1B glycoprotein ; Beta-1B-glycoprotein; FLJ56652; HEMO; HEMO_HUMAN; Hemopexin; Hpx; HX
Target Background
This gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phase protein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidative stress.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
