-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Inhibin beta A (INHBA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Inhibin beta A (INHBA) (P08476) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Inhibin beta A (INHBA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Inhibin beta A (INHBA) (P08476) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16735A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Inhibin beta A (INHBA) |
| Target Synonyms | EDF; FRP; Inhibin beta A (INHBA) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse uterus, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Inhibin beta A (INHBA) (P08476). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGY | Uniprot ID | P08476 |
Uniprot Id
P08476
Target Species
Human
Target Name
INHBA
Target Full Name
Inhibin beta A chain
Target Function
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Target Subcellular Location
Secreted.
Target Protein Families
TGF-beta family
Target Research Area
Signal Transduction
Target Synonyms
Activin beta-A chain; EDF; Erythroid differentiation factor; Erythroid differentiation protein; Follicle stimulating hormone releasing protein; FRP; FSH releasing protein; INHBA; INHBA_HUMAN; Inhibin beta A chain; Inhibin beta A subunit; Inhibin, beta 1; Inhibin, beta A (activin A, activin AB alpha polypeptide)
Target Background
This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. The encoded protein also plays a role in eye, tooth and testis development. Elevated expression of this gene may be associated with cancer cachexia in human patients.
Notification