-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITPK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 315-414 of human ITPK1 (Q13572) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ITPK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 315-414 of human ITPK1 (Q13572) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13331A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITPK1 |
| Target Synonyms | ITRPK1; ITPK1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NCI-H460 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 315-414 of human ITPK1 (Q13572). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HIATVLQGQSTAMAATGDVALLRHSKLLAEPAGGLVGERTCSASPGCCGSMMGQDAPWKAEADAGGTAKLPHQRLGCNAGVSPSFQQHCVASLATKASSQ | Uniprot ID | Q13572 |
Uniprot Id
Q13572
Target Species
Human
Target Name
ITPK1
Target Full Name
Inositol-tetrakisphosphate 1-kinase
Target Function
Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. Phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not. Also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway. Also acts as an inositol polyphosphate phosphatase that dephosphorylate Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 to Ins(1,3,4)P3, and Ins(1,3,4,5,6)P5 to Ins(3,4,5,6)P4. May also act as an isomerase that interconverts the inositol tetrakisphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. Probably acts as the rate-limiting enzyme of the InsP6 pathway. Modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain. Plays an important role in MLKL-mediated necroptosis. Produces highly phosphorylated inositol phosphates such as inositolhexakisphosphate (InsP6) which bind to MLKL mediating the release of an N-terminal auto-inhibitory region leading to its activation. Essential for activated phospho-MLKL to oligomerize and localize to the cell membrane during necroptosis.
Target Protein Families
ITPK1 family
Target Tissue Specificity
Expressed in brain > heart > skeletal muscle = kidney = pancreas = liver = placenta > lung. In brain, it is expressed in cerebellum, cerebral cortex, medulla, spinal cord, occipital lobe, frontal lobe, temporal lobe and putamen.
Target Synonyms
3; 4)P(3) 5/6-kinase; 4-trisphosphate 5/6-kinase; Inositol 1 3 4 triphosphate 5/6 kinase; Inositol 1 3 4 trisphosphate 5/6 kinase; Inositol 1; Inositol tetrakisphosphate 1 kinase; Inositol triphosphate 5/6 kinase; Inositol-tetrakisphosphate 1-kinase; Inositol-triphosphate 5/6-kinase; Ins(1 3 4)P(3) 5/6 kinase; Ins(1; ITPK 1; itpk1; ITPK1_HUMAN; ITRPK 1; ITRPK1
Target Background
This gene encodes an enzyme that belongs to the inositol 1, 3, 4-trisphosphate 5/6-kinase family. This enzyme regulates the synthesis of inositol tetraphosphate, and downstream products, inositol pentakisphosphate and inositol hexakisphosphate. Inositol metabolism plays a role in the development of the neural tube. Disruptions in this gene are thought to be associated with neural tube defects. A pseudogene of this gene has been identified on chromosome X.
Notification