-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Kallikrein 8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 161-260 of human Kallikrein 8 (O60259) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Kallikrein 8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 161-260 of human Kallikrein 8 (O60259) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15913A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Kallikrein 8 |
| Target Synonyms | NP; HNP; NRPN; PRSS19; TADG14; Kallikrein 8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, BxPC-3, Mouse uterus, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 161-260 of human Kallikrein 8 (O60259). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG | Uniprot ID | O60259 |
Uniprot Id
O60259
Target Species
Human
Target Name
KLK8
Target Full Name
Kallikrein-8
Target Function
Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.
Target Subcellular Location
Secreted. Cytoplasm. Note=Shows a cytoplasmic distribution in the keratinocytes.
Target Protein Families
Peptidase S1 family, Kallikrein subfamily
Target Tissue Specificity
Isoform 1 is predominantly expressed in the pancreas. Isoform 2 is expressed in adult brain and hippocampus. Isoform 1 and isoform 2 are found in fetal brain and placenta. Detected in salivary gland, uterus, thymus, breast, testis and kidney but not in sp
Target Synonyms
Brain serine protease 1; BSP1; hK8; HNP; HPN; Kallikrein 8 (neuropsin/ovasin); Kallikrein related peptidase 8; Kallikrein-8; Kallikrein8; KLK 8; Klk8; KLK8 protein type 1; KLK8 protein type 2; KLK8_HUMAN; Neuropsin; neuropsin type 1; Neuropsin type 1; included; Neuropsin type 2; Neuropsin type 2; included; Neuropsin; mouse; homolog of; NP; NRPN; Ovasin; PRO322; Protease serine 19; PRSS 19; PRSS19; Serine protease 19; Serine protease kallikrein; Serine protease kallikrein/ovasin/neuropsin; Serine protease TADG 14; Serine protease TADG-14; Serine protease TADG14; TADG 14; TADG14; Tumor associated differentially expressed gene 14; Tumor associated differentially expressed gene 14 protein; Tumor-associated differentially expressed gene 14 protein; UNQ283
Target Background
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.
Notification