Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Lumican (LUM) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 212-338 of human Lumican (LUM) (NP_002336.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Lumican (LUM) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 212-338 of human Lumican (LUM) (NP_002336.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16560A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Lumican (LUM) |
| Target Synonyms | LDC; SLRR2D; Lumican (LUM) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 212-338 of human Lumican (LUM) (NP_002336.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN | Uniprot ID | P51884 |
Uniprot Id
P51884
Target Species
Human
Target Name
LUM
Target Full Name
Lumican
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Small leucine-rich proteoglycan (SLRP) family, SLRP class II subfamily
Target Tissue Specificity
Cornea and other tissues.
Target Synonyms
Keratan sulfate proteoglycan lumican; KSPG lumican; LDC; LUM; LUM_HUMAN; Lumican; Lumican precursor; SLRR2D
Target Background
This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
