-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAGE-1/MAGE1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-309 of human MAGE-1/MAGE1A (P43355) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAGE-1/MAGE1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-309 of human MAGE-1/MAGE1A (P43355) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14108A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAGE-1/MAGE1A |
| Target Synonyms | CT1.1; MAGE1; MAGE-1/MAGE1A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A375, A549, Mouse lung, Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-309 of human MAGE-1/MAGE1A (P43355). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV | Uniprot ID | P43355 |
Uniprot Id
P43355
Target Species
Human
Target Name
MAGEA1
Target Full Name
Melanoma-associated antigen 1
Target Function
May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1. May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes. Never expressed in kidney tumors, leukemias and lymphomas.
Target Research Area
Cancer
Target Synonyms
Antigen MZ2 E; Antigen MZ2-E; Cancer/testis antigen 1.1; cancer/testis antigen family 1, member 1; CT1.1; MAGA1_HUMAN; MAGE 1 antigen; MAGE-1 antigen; MAGE1; MAGE1A; MAGEA1; Melanoma antigen 1; Melanoma antigen family A 1 (directs expression of antigen MZ2 E); Melanoma antigen family A 1; Melanoma antigen MAGE 1; Melanoma associated antigen 1; Melanoma associated antigen MZ2 E; Melanoma-associated antigen 1; MGC9326
Target Background
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.
Notification