-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Mineralocorticoid receptor (NR3C2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-600 of human Mineralocorticoid receptor (NR3C2) (NP_000892.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Mineralocorticoid receptor (NR3C2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-600 of human Mineralocorticoid receptor (NR3C2) (NP_000892.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14518A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Mineralocorticoid receptor (NR3C2) |
| Target Synonyms | MR; MCR; MLR; NR3C2VIT; Mineralocorticoid receptor (NR3C2) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 450-600 of human Mineralocorticoid receptor (NR3C2) (NP_000892.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FPFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS | Uniprot ID | P08235 |
Uniprot Id
P08235
Target Species
Human
Target Name
NR3C2
Target Full Name
Mineralocorticoid receptor
Target Function
Receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. Binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels.
Target Involvement
Pseudohypoaldosteronism 1, autosomal dominant (PHA1A); Early-onset hypertension with severe exacerbation in pregnancy (EOHSEP)
Target Subcellular Location
Cytoplasm. Nucleus. Endoplasmic reticulum membrane; Peripheral membrane protein. Note=Cytoplasmic and nuclear in the absence of ligand; nuclear after ligand-binding. When bound to HSD11B2, it is found associated with the endoplasmic reticulum membrane.
Target Protein Families
Nuclear hormone receptor family, NR3 subfamily
Target Tissue Specificity
Ubiquitous. Highly expressed in distal tubules, convoluted tubules and cortical collecting duct in kidney, and in sweat glands. Detected at lower levels in cardiomyocytes, in epidermis and in colon enterocytes.
Target Synonyms
Aldosterone receptor; MCR; MCR_HUMAN; MGC133092; Mineralocorticoid receptor; MLR; MR; NR3 C2; NR3C2; NR3C2 protein; Nuclear receptor subfamily 3 group C member 2
Target Background
This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.
Notification