-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS31 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 296-395 of human MRPS31 (Q92665) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRPS31 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 296-395 of human MRPS31 (Q92665) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13339A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS31 |
| Target Synonyms | S31mt; IMOGN38; MRP-S31; MRPS31 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, HepG2, Jurkat, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 296-395 of human MRPS31 (Q92665). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NGFEELIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLEKHLESFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKKDILKESNIQFN | Uniprot ID | Q92665 |
Uniprot Id
Q92665
Target Species
Human
Target Name
MRPS31
Target Full Name
Small ribosomal subunit protein mS31
Target Subcellular Location
Mitochondrion.
Target Protein Families
Mitochondrion-specific ribosomal protein mS31 family
Target Synonyms
28S ribosomal protein S31; 28S ribosomal protein S31; mitochondrial; Imogen 38; IMOGN38; mitochondrial; MRP-S31; MRPS31; RT31_HUMAN; S31mt
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. The 28S subunit of the mammalian mitoribosome may play a crucial and characteristic role in translation initiation. This gene encodes a 28S subunit protein that has also been associated with type 1 diabetes; however, its relationship to the etiology of this disease remains to be clarified. Pseudogenes corresponding to this gene have been found on chromosomes 3 and 13.
Notification