Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MS4A14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-280 of human MS4A14 (Q96JA4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MS4A14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-280 of human MS4A14 (Q96JA4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13303A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MS4A14 |
| Target Synonyms | MS4A16; NYD-SP21; MS4A14 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 150-280 of human MS4A14 (Q96JA4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FSRTLFIVLFFLPSDVTQNSEQPAPEENDQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPPTLEKKPSENMSIQLDSTFKQMKDEDLQ | Uniprot ID | Q96JA4 |
Uniprot Id
Q96JA4
Target Species
Human
Target Name
MS4A14
Target Full Name
Membrane-spanning 4-domains subfamily A member 14
Target Function
May be involved in signal transduction as a component of a multimeric receptor complex.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
MS4A family
Target Synonyms
MS4A14; MS4A13; MS4A16; Membrane-spanning 4-domains subfamily A member 14; Testis development protein NYD-SP21
Target Background
Predicted to be integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
