-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MSP/MST1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSP/MST1 (NP_066278.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MSP/MST1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSP/MST1 (NP_066278.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16181A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MSP/MST1 |
| Target Synonyms | MSP; HGFL; NF15S2; D3F15S2; DNF15S2; MSP/MST1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSP/MST1 (NP_066278.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDL | Uniprot ID | P26927 |
Uniprot Id
P26927
Target Species
Human
Target Name
MST1
Target Full Name
Hepatocyte growth factor-like protein
Target Involvement
MST1 variant Cys-689 may be associated with inflammatory bowel disease (IBD), a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is unsure whether Cys-689 itself or a variation in linkage disequilibrium with Cys-689 is responsible for the association with IBD.
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase S1 family, Plasminogen subfamily
Target Synonyms
D3F15S2; DNF15S2; Hepatocyte growth factor like protein alpha chain; Hepatocyte growth factor like protein; Hepatocyte growth factor like protein beta chain; Hepatocyte growth factor like protein homolog; Hepatocyte growth factor-like protein beta chain; HGFL; HGFL_HUMAN; Macrophage stimulating 1 (hepatocyte growth factor like); Macrophage stimulatory protein; Macrophage-stimulating protein; MSP; MST1; NF15S2; OTTHUMP00000208927
Target Background
The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds.
Notification