-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MTA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 569-668 of human MTA2 (O94776) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.
The antibody against MTA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 569-668 of human MTA2 (O94776) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.
| Cat.No | ADA-17182A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MTA2 |
| Target Synonyms | PID; MTA1L1; A2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB, ChIP, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 569-668 of human MTA2 (O94776). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED | Uniprot ID | O94776 |
Uniprot Id
O94776
Target Species
Human
Target Name
MTA2
Target Full Name
Metastasis-associated protein MTA2
Target Function
May be involved in the regulation of gene expression as repressor and activator. The repression might be related to covalent modification of histone proteins.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Widely expressed.
Target Synonyms
DKFZp686F2281; Mata1l1; Metastasis associated 1 family member 2; Metastasis associated 1 like 1; Metastasis associated gene 1 like 1; Metastasis associated gene family member 2; Metastasis associated protein 2; Metastasis associated protein MTA 2; Metastasis associated protein MTA2; Metastasis-associated 1-like 1; Metastasis-associated protein MTA2; Mmta2; MTA1 L1 protein; MTA1-L1 protein; MTA1L1; MTA2; MTA2_HUMAN; p53 target protein in deacetylase complex; PID
Target Background
This gene encodes a protein that has been identified as a component of NuRD, a nucleosome remodeling deacetylase complex identified in the nucleus of human cells. It shows a very broad expression pattern and is strongly expressed in many tissues. It may represent one member of a small gene family that encode different but related proteins involved either directly or indirectly in transcriptional regulation. Their indirect effects on transcriptional regulation may include chromatin remodeling. It is closely related to another member of this family, a protein that has been correlated with the metastatic potential of certain carcinomas. These two proteins are so closely related that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. One of the proteins known to be a target protein for this gene product is p53. Deacetylation of p53 is correlated with a loss of growth inhibition in transformed cells supporting a connection between these gene family members and metastasis.
Notification