-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MTAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 184-283 of human MTAP (Q13126) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against MTAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 184-283 of human MTAP (Q13126) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-13464A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MTAP |
| Target Synonyms | BDMF; MSAP; DMSFH; LGMBF; DMSMFH; c86fus; HEL-249; MTAP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, Mouse kidney, HT-29, Mouse liver, Rat liver, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 184-283 of human MTAP (Q13126). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH | Uniprot ID | Q13126 |
Uniprot Id
Q13126
Target Species
Human
Target Name
MTAP
Target Full Name
S-methyl-5'-thioadenosine phosphorylase
Target Function
Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.
Target Involvement
Diaphyseal medullary stenosis with malignant fibrous histiocytoma (DMSMFH)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
PNP/MTAP phosphorylase family, MTAP subfamily
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
5' methylthioadenosine phosphorylase; 5''-methylthioadenosine phosphorylase; BDMF; c86fus; DMSFH; DMSMFH; Epididymis luminal protein 249; HEL 249; LGMBF; MeSAdo phosphorylase; Methylthioadenosine phosphorylase; MSAP; MTA phosphorylase; MTAP; MTAP_HUMAN; MTAPase; S methyl 5 thioadenosine phosphorylase; S methyl 5' thioadenosine phosphorylase; S-methyl-5''-thioadenosine phosphorylase
Target Background
This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage pathway of both adenine and methionine. The encoded enzyme is deficient in many cancers. Multiple alternatively spliced transcript variants have been described for this gene.
Notification