-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Musashi-1 (MSI1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSI1 (O43347) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Musashi-1 (MSI1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSI1 (O43347) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14183A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Musashi-1 (MSI1) |
| Target Synonyms | MSI1; musashi RNA binding protein 1; Musashi-1 (MSI1) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSI1 (O43347). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRA | Uniprot ID | O43347 |
Uniprot Id
O43347
Target Species
Human
Target Name
MSI1
Target Full Name
RNA-binding protein Musashi homolog 1
Target Function
RNA binding protein that regulates the expression of target mRNAs at the translation level. Regulates expression of the NOTCH1 antagonist NUMB. Binds RNA containing the sequence 5'-GUUAGUUAGUUAGUU-3' and other sequences containing the pattern 5'-[GA]U(1-3)AGU-3'. May play a role in the proliferation and maintenance of stem cells in the central nervous system.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Musashi family
Target Tissue Specificity
Detected in fetal kidney, brain, liver and lung, and in adult brain and pancreas. Detected in hepatoma cell lines.
Target Synonyms
Msi 1; Msi1; MSI1H_HUMAN; Musashi homolog 1; Musashi RNA binding protein 1; Musashi-1; Musashi1; RNA binding protein Musashi homolog 1; RNA-binding protein Musashi homolog 1
Target Background
This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
Notification