-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Nectin 2/CD112 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-538 of human Nectin 2/CD112 (ARC1665) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Nectin 2/CD112 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-538 of human Nectin 2/CD112 (ARC1665) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14054A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Nectin 2/CD112 |
| Target Synonyms | HVEB; PRR2; CD112; PVRL2; PVRR2; Nectin 2/CD112 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 410-538 of human Nectin 2/CD112 (ARC1665). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPKAKLEAQEMPSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPVPPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV | Uniprot ID | Q92692 |
Uniprot Id
Q92692
Target Species
Human
Target Name
NECTIN2
Target Full Name
Nectin-2
Target Function
Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive. Probable cell adhesion protein.; (Microbial infection) Acts as a receptor for herpes simplex virus 1 (HHV-1) mutant Rid1, herpes simplex virus 1 (HHV-2) and pseudorabies virus (PRV).
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Nectin family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Immunology
Target Synonyms
CD 112; CD112; CD112 antigen; Herpes virus entry mediator B; Herpes virus entry protein B; Herpesvirus entry mediator B; Herpesvirus entry protein B; Hve B; HveB; Nectin-2; Nectin2; Poliovirus receptor like 2; Poliovirus receptor related 2 (herpesvirus entry mediator B); Poliovirus receptor related 2; Poliovirus receptor related protein 2; Poliovirus receptor-related protein 2; PRR 2; PRR2; PVRL 2; PVRL2; PVRL2_HUMAN; PVRR 2; PVRR2
Target Background
This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Notification