Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Neurogenin 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human Neurogenin 2 (Q9H2A3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Neurogenin 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human Neurogenin 2 (Q9H2A3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14272A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Neurogenin 2 |
| Target Synonyms | NGN2; Atoh4; ngn-2; Math4A; bHLHa8; Neurogenin 2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, Mouse brain, Neuro-2a, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Neurogenin 2 (Q9H2A3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTK | Uniprot ID | Q9H2A3 |
Uniprot Id
Q9H2A3
Target Species
Human
Target Name
NEUROG2
Target Full Name
Neurogenin-2
Target Function
Transcriptional regulator. Involved in neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3').
Target Subcellular Location
Nucleus.
Target Synonyms
Atoh 4; Atoh4; bHLHa8; Class A basic helix-loop-helix protein 8; Math 4A; Math4A; MGC; MGC46562; NEUROG 2; NEUROG2; Neurogenin-2; Neurogenin2; NGN 2; NGN-2; NGN2; NGN2_HUMAN; Protein atonal homolog 4
Target Background
This gene encodes a neural-specific basic helix-loop-helix (bHLH) transcription factor that can specify a neuronal fate on ectodermal cells and is expressed in neural progenitor cells within the developing central and peripheral nervous systems. The protein product of this gene also plays a role in the differentiation and survival of midbrain dopaminergic neurons.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
