Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NY-ESO-1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NY-ESO-1 (P78358) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NY-ESO-1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NY-ESO-1 (P78358) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14548A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NY-ESO-1 |
| Target Synonyms | CTAG; ESO1; CT6.1; CTAG1; LAGE-2; LAGE2B; NY-ESO-1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-1080 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NY-ESO-1 (P78358). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPM | Uniprot ID | P78358 |
Uniprot Id
P78358
Target Species
Human
Target Name
CTAG1A
Target Full Name
Cancer/testis antigen 1
Target Subcellular Location
Cytoplasm.
Target Protein Families
CTAG/PCC1 family
Target Tissue Specificity
Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in
Target Research Area
Cancer
Target Synonyms
CTAG1A; CTAG1B; Autoimmunogenic cancer/testis antigen NY ESO 1; Autoimmunogenic cancer/testis antigen NY-ESO-1; Cancer antigen 3; Cancer/testis antigen 1; Cancer/testis antigen 1B ; Cancer/testis antigen 6.1; CT6.1; CTAG 1; CTAG 1B; CTAG; CTAG1; CTAG1B; CTG1B_HUMAN; ESO 1; ESO1; L antigen family member 2; LAGE 2; LAGE 2 protein; LAGE 2B; LAGE-2; LAGE2; LAGE2 protein; LAGE2A; LAGE2B; New York esophageal squamous cell carcinoma 1; NY ESO 1; NYESO 1; NYESO1
Target Background
The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
