Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OTX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human OTX1 (NP_055377.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OTX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human OTX1 (NP_055377.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13521A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OTX1 |
| Form | Liquid | Species Reactivity | Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | Rat brain, Mouse brain |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OTX1 (NP_055377.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSG | Uniprot ID | P32242 |
Uniprot Id
P32242
Target Species
Human
Target Name
OTX1
Target Full Name
Homeobox protein OTX1
Target Function
Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family, Bicoid subfamily
Target Tissue Specificity
Expressed in brain. Detected in the anterior part of the neural fetal retina (at protein level).
Target Synonyms
FLJ38361; Homeobox protein OTX 1; Homeobox protein OTX1; MGC15736; Orthodenticle 1; Orthodenticle homeobox 1; Orthodenticle homolog 1; Orthodenticle1; Otx 1; otx1; OTX1_HUMAN
Target Background
This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mouse is required for proper brain and sensory organ development and can cause epilepsy. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
