-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLSCR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLSCR3 (Q9NRY6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PLSCR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLSCR3 (Q9NRY6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13397A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLSCR3 |
| Target Synonyms | PLSCR3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, A-431, Mouse brain, Mouse lung, PC-3, Rat lung, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLSCR3 (Q9NRY6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGW | Uniprot ID | Q9NRY6 |
Uniprot Id
Q9NRY6
Target Species
Human
Target Name
PLSCR3
Target Full Name
Phospholipid scramblase 3
Target Function
Catalyzes calcium-induced ATP-independent rapid bidirectional and non-specific movement of the phospholipids (lipid scrambling or lipid flip-flop) between the inner and outer membrane of the mitochondria. Plays an important role in mitochondrial respiratory function, morphology, and apoptotic response. Mediates the translocation of cardiolipin from the mitochondrial inner membrane to outer membrane enhancing t-Bid induced cytochrome c release and apoptosis. Enhances TNFSF10-induced apoptosis by regulating the distribution of cardiolipin in the mitochondrial membrane resulting in increased release of apoptogenic factors and consequent amplification of the activity of caspases. Regulates cardiolipin de novo biosynthesis and its resynthesis
Target Subcellular Location
Mitochondrion membrane; Single-pass type II membrane protein. Mitochondrion inner membrane; Single-pass type II membrane protein. Nucleus.
Target Protein Families
Phospholipid scramblase family
Target Tissue Specificity
Expressed in heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, uterus, small intestine and peripheral blood lymphocytes. Not detected in testis, brain and liver.
Target Synonyms
Ca(2+)-dependent phospholipid scramblase 3; Phospholipid scramblase 3; PL scramblase 3; PLS3; PLS3_HUMAN; Plscr3
Target Background
Enables several functions, including calcium-dependent protein binding activity; metal ion binding activity; and phospholipid scramblase activity. Involved in several processes, including cardiolipin biosynthetic process; regulation of apoptotic process; and regulation of release of cytochrome c from mitochondria. Located in cytosol; mitochondrion; and plasma membrane.
Notification